PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G00330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 500aa    MW: 54155.5 Da    PI: 6.6185
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G00330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS253.96.1e-781294992374
             GRAS   2 velLlecAeavssgdlelaqalLar..lsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfsevsP 89 
                      ve+L+++A+  ++gd  +a+++Lar  ++ +  ++++ p+ R a yf+ AL++ l +  ++ +++ pp + +e +      +l+++k fs++sP
  ORUFI03G00330.1 129 VEQLVQAAKLTEAGDVLAARHILARpaINYRlPASAAPPLLRSALYFKDALRRALISDDDSSSSSTPPPPLHEPHphdLLLKLTSYKSFSDLSP 222
                      689*********************85466656777889******************977777777766555544444488899999******** PP

             GRAS  90 ilkfshltaNqaIleavege.ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefn 179
                      +l f+h+t+ qa+l++++ + +++H +Dfdi+ G QW++L++ La R  +   l++T+++  +s+   +  +l+ +++ L+ fA+ l vpf+f 
  ORUFI03G00330.1 223 LLHFAHFTCVQAVLDELAPSaSCIHLLDFDIGVGEQWASLMHDLAHRH-PGVALKVTALNVTASSsshHPLQLQLIHDTLSTFAADLSVPFRFA 315
                      ****************9988799************************6.44799***998876666668899********************** PP

             GRAS 180 vlvakrledleleeL.rvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                      ++   +l++ +l  L +v    +a+aV+l +   +      +     ++vL+lv++l +k+vv v++ +d+++ +F++++l+al+  ++l++sl
  ORUFI03G00330.1 316 AF---NLDATDLTPLlAVAAaTDAIAVHLPVGSVHAT----A----VPSVLHLVRRLGAKLVVSVDRGCDRGELPFAAHLLQALRSTVSLLESL 398
                      *7...5555555554255557*********9888887....4....456********************************************* PP

             GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                      +a  +++s+ ++k+Er++++++i+++v ++      +++ ++ Wr+ l +aGF pv++s+ a++qa++ll+k +++g+r+e + gsl+l W++ 
  ORUFI03G00330.1 399 DAM-GTDSDVAAKIERFWVQPKIQECVRAAVGV-GGDKTAASAWRATLASAGFVPVQVSSMAEAQAESLLKKLPVRGFRLERRAGSLFLHWQRG 490
                      998.99*********************988776.6888899***************************************************** PP

             GRAS 366 pLvsvSaWr 374
                      +L svSaWr
  ORUFI03G00330.1 491 ELASVSAWR 499
                      ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.183102479IPR005202Transcription factor GRAS
PfamPF035142.1E-75129499IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MWGWGRERCS LPALESAKRE GEIELVDVWG PSSSSFTLTS PGLRPPTHAA STPPPPPWLD  60
DADHHHDNAF LHWVINDHHH PLLDLDDVDL DYAKPAPFFF ADRGLHHHHP ASSSFPNPKP  120
TADDNTSTVE QLVQAAKLTE AGDVLAARHI LARPAINYRL PASAAPPLLR SALYFKDALR  180
RALISDDDSS SSSTPPPPLH EPHPHDLLLK LTSYKSFSDL SPLLHFAHFT CVQAVLDELA  240
PSASCIHLLD FDIGVGEQWA SLMHDLAHRH PGVALKVTAL NVTASSSSHH PLQLQLIHDT  300
LSTFAADLSV PFRFAAFNLD ATDLTPLLAV AAATDAIAVH LPVGSVHATA VPSVLHLVRR  360
LGAKLVVSVD RGCDRGELPF AAHLLQALRS TVSLLESLDA MGTDSDVAAK IERFWVQPKI  420
QECVRAAVGV GGDKTAASAW RATLASAGFV PVQVSSMAEA QAESLLKKLP VRGFRLERRA  480
GSLFLHWQRG ELASVSAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-2516449936375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1186730.0AC118673.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0080O10, from chromosome 3, complete sequence.
GenBankAC1254110.0AC125411.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNAb0079B22, from chromosome 3, complete sequence.
GenBankAF4858110.0AF485811.1 Oryza sativa BAC OSJNa0049F05, complete sequence.
GenBankAK1193240.0AK119324.1 Oryza sativa Japonica Group cDNA clone:001-131-A10, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629082.10.0PREDICTED: scarecrow-like protein 6, partial
TrEMBLA0A0E0NNI70.0A0A0E0NNI7_ORYRU; Uncharacterized protein
STRINGBGIOSGA011665-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67232954
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.14e-57GRAS family protein